Structure of PDB 8rxx Chain LD Binding Site BS02

Receptor Information
>8rxx Chain LD (length=175) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKAANPMREIVVKKLCINICVGESGDRLTRASKVLEQLCEQTPVLSRARL
TVRTFGIRRNEKIAVHCTVRGKKAEELLEKGLKVKEFELKSYNFADTGSF
GFGIDEHIDLGIKYDPSTGIYGMDFYVVLGRRGERVAHRKRKCSRVGHSH
HVTKEEAMKWFEKVHDGIIFQAKKK
Ligand information
>8rxx Chain L8 (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaguacgaccacacuugagugaaaacaccauaucccguccgauuugugaa
guuaagcacucacaggcucaguuaguacugaggucagugaugacucggga
acccugagugccguacucc
<<<<<<<......<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<......<<<<<..<<....>>.>>>>>..
...>>>>>>..>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.97 Å
Binding residue
(original residue number in PDB)		K6 N9 P10 M11 R12 Q45 T46 V48 T72 R74 R136 G137 R139 V140 R143 K146 S148 R149 G151 H152 H154
Binding residue
(residue number reindexed from 1)		K2 N5 P6 M7 R8 Q41 T42 V44 T68 R70 R132 G133 R135 V136 R139 K142 S144 R145 G147 H148 H150
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum8rxx
PubMed38722744
UniProtP48157|RL11_LEIMA Large ribosomal subunit protein uL5 (Gene Name=RPL11)

[Back to BioLiP]