Structure of PDB 8pv6 Chain LD Binding Site BS02

Receptor Information
>8pv6 Chain LD (length=298) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HKLVKNSAYYSRFQTKFKRRRQGKTDYYARKRLITQAKNKYNAPKYRLVV
RFTNRDIITQMVTSEINGDKIFAAAYSHELRAYGINHGLTNWAAAYATGL
LLARRVLAKLGLDKTFTGVEEPNGEYTLTEAAETEDGERRPFKAILDVGL
ARTSTGARVFGVMKGASDGGIFIPHSENRFPGYDIETEELDTEVLKKYIY
GGHVAEYMETLADDDEERYKSQFVKYIEDDVEADSLEELYAEAHKQIRAD
PFRKYVSDAPKKSKEEWKAESLKYKKAKLSREERKARVEAKIKQLLAE
Ligand information
>8pv6 Chain C4 (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acguacgaccauacccaguggaaagcacggcaucccguccgcucugcccu
aguuaagccacugagggcccgguuaguaguugggucgggaccagcgaauc
ccggguguuguacgu
<<<<<<<<<....<<<<<<<<.....<<<<<<............>>>>..
.>>....>>>>>>.>><<<<<<......<<<<<.......>>>>>.....
>>>>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pv6 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
Resolution2.94 Å
Binding residue
(original residue number in PDB)		S10 Y13 S14 F16 T18 F20 K21 R22 R24 T28 R33 R50 R54 T56 N57 R58 I61 D72 K73 I74 G91 N94 W95 R155 T158 G159 A160 R161 Y201 H206 Y210 Q225 F226 K228 Y229 S260 P263 K264 K267 W270 K271 S274 Y277 K281 L282 R284 R290 I295
Binding residue
(residue number reindexed from 1)		S7 Y10 S11 F13 T15 F17 K18 R19 R21 T25 R30 R47 R51 T53 N54 R55 I58 D69 K70 I71 G88 N91 W92 R152 T155 G156 A157 R158 Y198 H203 Y207 Q222 F223 K225 Y226 S257 P260 K261 K264 W267 K268 S271 Y274 K278 L279 R281 R287 I292
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pv6, PDBe:8pv6, PDBj:8pv6
PDBsum8pv6
PubMed37921038
UniProtG0SEG2

[Back to BioLiP]