Structure of PDB 8pv1 Chain LD Binding Site BS02

Receptor Information
>8pv1 Chain LD (length=286) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KLVKNSAYYSRFQTKFKRRRQGKTDYYARKRLITQAKNKYNAPKYRLVVR
FTNRDIITQMVTSEINGDKIFAAAYSHELRAYGINHGLTNWAAAYATGLL
LARRVLAKLGLDGEYTLTEAAETEDGERRPFKAILDVGLARTSTGARVFG
VMKGASDGGIFIPHSENRFPGYDIETEELDTEVLKKYIYGGHVAEYMETL
ADDDEERYKSQFVKYIEDDVEADSLEELYAEAHKQIRADPFRKYVSDAPK
KSKEEWKAESLKYKKAKLSREERKARVEAKIKQLLA
Ligand information
>8pv1 Chain C4 (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acguacgaccauacccaguggaaagcacggcaucccguccgcucugcccu
aguuaagccacugagggcccgguuaguaguugggucggugacgaccagcg
aaucccggguguuguacgu
<<<<<<<<<....<<<<<<<<.....<<<<<<............>>>>..
.>>....>>>>>>.>><<<<<<......<<<<.<<<<....>>>>>>>>.
....>>>>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8pv1 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
Resolution2.56 Å
Binding residue
(original residue number in PDB)		K8 S10 Y13 S14 F16 T18 F20 K21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 R58 I61 Q63 I69 N70 G71 D72 K73 I74 Y79 G91 N94 W95 R155 T158 G159 A160 R161 Y201 V207 Y210 Q225 V227 K228 Y229 K264 K267 W270 K271 S274 Y277 K278 K281 L282 R284 R287 R290
Binding residue
(residue number reindexed from 1)		K4 S6 Y9 S10 F12 T14 F16 K17 R18 R20 T24 Y26 R29 R46 R50 T52 N53 R54 I57 Q59 I65 N66 G67 D68 K69 I70 Y75 G87 N90 W91 R141 T144 G145 A146 R147 Y187 V193 Y196 Q211 V213 K214 Y215 K250 K253 W256 K257 S260 Y263 K264 K267 L268 R270 R273 R276
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8pv1, PDBe:8pv1, PDBj:8pv1
PDBsum8pv1
PubMed37921038
UniProtG0SEG2

[Back to BioLiP]