Structure of PDB 8oo0 Chain LD Binding Site BS02

Receptor Information
>8oo0 Chain LD (length=300) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FHKLVKNSAYYSRFQTKFKRRRQGKTDYYARKRLITQAKNKYNAPKYRLV
VRFTNRDIITQMVTSEINGDKIFAAAYSHELRAYGINHGLTNWAAAYATG
LLLARRVLAKLGLDKTFTGVEEPNGEYTLTEAAETEDGERRPFKAILDVG
LARTSTGARVFGVMKGASDGGIFIPHSENRFPGYDIETEELDTEVLKKYI
YGGHVAEYMETLADDDEERYKSQFVKYIEDDVEADSLEELYAEAHKQIRA
DPFRKYVSDAPKKSKEEWKAESLKYKKAKLSREERKARVEAKIKQLLAEQ
Ligand information
>8oo0 Chain 3 (length=119) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acauacgaccauaccuaguggaaaacucgggaucccguccgcucucccau
agauaagccacuaagggcgggguuaguacucaggucggugacgacugggg
aaucccccguguuguaugu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
.>>....>>>>>>.>><<<<<<......<<<<<..<<....>>.>>>>>.
....>>>>>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Y13 S14 F16 T18 K21 R22 R24 T28 Y30 R33 R54 N57 R58 Q63 G71 D72 I74 N94 W95 T158 R161 H206 Y210 R221 Q225 K228 K267 W270 K271 S274 Y277 K281 L282 R284 R287 K294
Binding residue
(residue number reindexed from 1)		Y11 S12 F14 T16 K19 R20 R22 T26 Y28 R31 R52 N55 R56 Q61 G69 D70 I72 N92 W93 T156 R159 H204 Y208 R219 Q223 K226 K265 W268 K269 S272 Y275 K279 L280 R282 R285 K292
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
PDBsum8oo0
PubMed38267453
UniProtG0SEG2

[Back to BioLiP]