Structure of PDB 7rr5 Chain LD Binding Site BS02

Receptor Information
>7rr5 Chain LD (length=294) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVV
RFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGL
LIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRT
TTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGH
VSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAF
KPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>7rr5 Chain C4 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<<............>>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rr5 Conserved heterodimeric GTPase Rbg1/Tma46 promotes efficient translation in eukaryotic cells.
Resolution3.23 Å
Binding residue
(original residue number in PDB)		D6 K8 S13 S14 F16 T18 F20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 K58 I65 I69 D72 V74 Y79 H90 G91 N94 Q151 R152 T154 A157 R158 Y198 H203 Y207 E221 L222 K224 T256 K258 K259 F260 K262 Q264 Y265 A266 E268 S269 Y272 R273 Q274 K276 L277 R282 R285
Binding residue
(residue number reindexed from 1)		D3 K5 S10 S11 F13 T15 F17 R18 R19 R21 T25 Y27 R30 R47 R51 T53 N54 K55 I62 I66 D69 V71 Y76 H87 G88 N91 Q148 R149 T151 A154 R155 Y195 H200 Y204 E218 L219 K221 T253 K255 K256 F257 K259 Q261 Y262 A263 E265 S266 Y269 R270 Q271 K273 L274 R279 R282
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 29 22:36:09 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7rr5', asym_id = 'LD', bs = 'BS02', title = 'Conserved heterodimeric GTPase Rbg1/Tma46 promotes efficient translation in eukaryotic cells.'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7rr5', asym_id='LD', bs='BS02', title='Conserved heterodimeric GTPase Rbg1/Tma46 promotes efficient translation in eukaryotic cells.')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003735,0005840,0006412,0008097', uniprot = '', pdbid = '7rr5', asym_id = 'LD'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0008097', uniprot='', pdbid='7rr5', asym_id='LD')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>