Structure of PDB 7cpv Chain LD Binding Site BS02

Receptor Information
>7cpv Chain LD (length=293) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GFVKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRM
IVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCT
GLLLARRLLNRFGMDKIYEGQVEVNGGEYNVESIDGQPGAFTCYLDAGLA
RTTTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMG
QNVADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENP
VYEKKPKREVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERA
Ligand information
>7cpv Chain L7 (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gucuacggccauaccacccugaacgcgcccgaucucgucugaucucggaa
gcuaagcagggucgggccugguuaguacuuggaugggagaccgccuggga
auaccgggugcuguaggcuu
<<<<<<<<<....<<<<<<<<.....<<<<<..............>>>..
>>....>>>>>>.>><<<<<<<.....<<.<<..<<....>>.>>.>>..
..>>>>>>>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7cpv A male germ-cell-specific ribosome controls male fertility.
Resolution3.03 Å
Binding residue
(original residue number in PDB)		K10 F13 K14 Y16 V18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 I52 R54 T56 N57 R58 Q63 I69 E70 G71 D72 M73 I74 Y79 N94 Y95 R152 T155 G156 N157 K158 Y207 Q222 F223 S224 Q225 Y226 Y253 K255 K256 K258 E260 V261 K262 R265 W266 N267 R268 P269 K270 M271 L273 K276 R279 V280
Binding residue
(residue number reindexed from 1)		K9 F12 K13 Y15 V17 F19 R20 R21 R23 K26 T27 Y29 R32 R49 I51 R53 T55 N56 R57 Q62 I68 E69 G70 D71 M72 I73 Y78 N93 Y94 R151 T154 G155 N156 K157 Y206 Q221 F222 S223 Q224 Y225 Y252 K254 K255 K257 E259 V260 K261 R264 W265 N266 R267 P268 K269 M270 L272 K275 R278 V279
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0140236 translation at presynapse
GO:0140242 translation at postsynapse
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0045202 synapse
GO:0098793 presynapse
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7cpv, PDBe:7cpv, PDBj:7cpv
PDBsum7cpv
PubMed36517592
UniProtP47962|RL5_MOUSE Large ribosomal subunit protein uL18 (Gene Name=Rpl5)

[Back to BioLiP]