Structure of PDB 4wsd Chain L8 Binding Site BS02

Receptor Information
>4wsd Chain L8 (length=57) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRLKVKLVKSPIGYPKDQKAALKALGLRRLQQERVLEDTPAIRGNVEKVA
HLVRVEV
Ligand information
>4wsd Chain 16 (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcggggga
...<<<<<<<<<<....<<<<<<<<....<<<<<<...............
>>>..>>>...>>>>>>.>><<<.......<<<<<<<<....>>>>>>>>
.......>>>.>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4wsd Structural insights into the translational infidelity mechanism.
Resolution2.95 Å
Binding residue
(original residue number in PDB)
Y15 Q19 H52
Binding residue
(residue number reindexed from 1)
Y14 Q18 H51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4wsd, PDBe:4wsd, PDBj:4wsd
PDBsum4wsd
PubMed26037619
UniProtQ5SHQ6|RL30_THET8 Large ribosomal subunit protein uL30 (Gene Name=rpmD)

[Back to BioLiP]