Structure of PDB 4u51 Chain L5 Binding Site BS02

Receptor Information
>4u51 Chain L5 (length=296) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ
Ligand information
>4u51 Chain 3 (length=121) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gguugcggccauaucuaccagaaagcaccguuucccguccgaucaacugu
aguuaagcugguaagagccugaccgaguaguguagugggugaccauacgc
gaaacucaggugcugcaaucu
<<<<<<<<<....<<<<<<<<.....<<.<<..............>>...
.>>....>>>>>>.>><<<<<<.......<<<<<..<<....>>.>>>>>
.....>>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4u51 ?
Resolution3.2 Å
Binding residue
(original residue number in PDB)		A2 S10 S13 S14 T18 F20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 K58 I61 Q63 I69 T70 G71 D72 V73 V74 Y79 G91 N94 Q151 R152 T154 T155 A157 R158 Y198 H203 V204 Y207 R218 E221 L222 K224 Y226 P255 T256 K259 F260 K262 Q264 Y265 A266 E268 S269 Y272 Q274 K276 L277 R282 R285
Binding residue
(residue number reindexed from 1)		A1 S9 S12 S13 T17 F19 R20 R21 R23 T27 Y29 R32 R49 R53 T55 N56 K57 I60 Q62 I68 T69 G70 D71 V72 V73 Y78 G90 N93 Q150 R151 T153 T154 A156 R157 Y197 H202 V203 Y206 R217 E220 L221 K223 Y225 P254 T255 K258 F259 K261 Q263 Y264 A265 E267 S268 Y271 Q273 K275 L276 R281 R284
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4u51, PDBe:4u51, PDBj:4u51
PDBsum4u51
PubMed25209664
UniProtP26321|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]