Structure of PDB 8hku Chain L44E Binding Site BS02

Receptor Information
>8hku Chain L44E (length=92) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKVPKVIKTYCPKCKTHTEHSVSLYKGGKRRSLAEGQRRYERKNVGYGSK
RKPEQKRFAKTTKKQTLVLKCQKCSYTIVKEGMRLKKLELVE
Ligand information
>8hku Chain AETN (length=18) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauccgggcacca
<<<<<<..>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
Resolution2.72 Å
Binding residue
(original residue number in PDB)		Y40 K52 P53
Binding residue
(residue number reindexed from 1)		Y40 K52 P53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hku, PDBe:8hku, PDBj:8hku
PDBsum8hku
PubMed37604686
UniProtQ4J9B2

[Back to BioLiP]