Structure of PDB 8hkz Chain L30P Binding Site BS02

Receptor Information
>8hkz Chain L30P (length=155) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNELIGVIRIRGWAATPWYIQDTLSMLRLKNAFNAMIYPKDSSIQGMLNL
VSSYVTWGELNDEGLRLLVSKLEISRGKKVNEEYVKDKLNVDFQSFVESI
KDGKLRLNKLDEIFSLPIRLHPPKGGFKGKVSRPFRAGGEFGYRGDKINE
LIRRM
Ligand information
>8hkz Chain A5S (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugcccacccggucauagugagcggguaacacccggacucguuucgaaccc
ggaaguuaagccgcucacgucagaggggccgugggauccgagagggcccg
cagccucucugagcugggaugg
......<<.<......<<<<<<<<.....<<<<<...............>
>>..>>....>>>>>>>>.<<<<<.<<<<.<<<<<..<<....>>.>>>>
>.>>>>.>>>>>..>.>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
Resolution4.78 Å
Binding residue
(original residue number in PDB)		R133 F135 A137
Binding residue
(residue number reindexed from 1)		R133 F135 A137
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtO05642|RL30_SULAC Large ribosomal subunit protein uL30 (Gene Name=rpl30)

[Back to BioLiP]