Structure of PDB 8hku Chain L30P Binding Site BS02

Receptor Information

>8hku Chain L30P (length=155) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MNELIGVIRIRGWAATPWYIQDTLSMLRLKNAFNAMIYPKDSSIQGMLNL
VSSYVTWGELNDEGLRLLVSKLEISRGKKVNEEYVKDKLNVDFQSFVESI
KDGKLRLNKLDEIFSLPIRLHPPKGGFKGKVSRPFRAGGEFGYRGDKINE
LIRRM

Ligand information

>8hku Chain A5S (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ugcccacccggucauagugagcggguaacacccggacucguuucgaaccc
ggaaguuaagccgcucacgucagaggggccgugggauccgagagggcccg
cagccucucugagcugggaugg

..<<..<<<<<<....<<<<<<<<.....<<<<<...............>
>>..>>....>>>>>>>>.<<<<<<<<<<.<<<<<..<<....>>.>>>>
>.>>>>>>>>>>>>>>>>..>>

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
Resolution	2.72 Å
Binding residue (original residue number in PDB)	R133 F135 R136
Binding residue (residue number reindexed from 1)	R133 F135 R136

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hku, PDBe:8hku, PDBj:8hku
PDBsum	8hku
PubMed	37604686
UniProt	O05642\|RL30_SULAC Large ribosomal subunit protein uL30 (Gene Name=rpl30)

[Back to BioLiP]