Structure of PDB 8hl2 Chain L21E Binding Site BS02

Receptor Information
>8hl2 Chain L21E (length=97) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VARSKGYRSKTRKLLEKKVREKGAIPKLSLLMHDYSQGEYVVVKINPSIH
KGMPHRRYHGKVGLVVGKRGKAYEVKVNIGDKERVLIVRPEHLIPFN
Ligand information
>8hl2 Chain A5S (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugcccacccggucauagugagcggguaacacccggacucguuucgaaccc
ggaaguuaagccgcucacgucagaggggccgugggauccgagagggcccg
cagccucucugagcugggaugg
..<<..<<<<<<....<<<<<<<<.....<<<<<...............>
>>..>>....>>>>>>>>.<<<<<<<<<<.<<<<<..<<....>>.>>>>
>.>>>>>>>>>>>>>>>>..>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hl2 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
Resolution4.1 Å
Binding residue
(original residue number in PDB)		R21 K28 S30
Binding residue
(residue number reindexed from 1)		R20 K27 S29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hl2, PDBe:8hl2, PDBj:8hl2
PDBsum8hl2
PubMed37604686
UniProtQ4JB11|RL21_SULAC Large ribosomal subunit protein eL21 (Gene Name=rpl21e)

[Back to BioLiP]