Structure of PDB 8hku Chain L18P Binding Site BS02

Receptor Information
>8hku Chain L18P (length=193) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TQGPNYRIKFRRRREGKTDYYTRYTYVINNAIRFVPRLTNKYVIVSVSKF
DQKGDIMIAYAHSIELVKKYGWKGDTNNTPAAYLTGYLAGLRAVKSGVKA
AVSDIGLFVPVKGGRIFAVIKGAIDAGLKVPVGDLGKLKDRVNGSHISAY
AQKLKNENQELYNKLFSSYIQRGLDPVLLPQHFEEVLNKIKEN
Ligand information
>8hku Chain A5S (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugcccacccggucauagugagcggguaacacccggacucguuucgaaccc
ggaaguuaagccgcucacgucagaggggccgugggauccgagagggcccg
cagccucucugagcugggaugg
..<<..<<<<<<....<<<<<<<<.....<<<<<...............>
>>..>>....>>>>>>>>.<<<<<<<<<<.<<<<<..<<....>>.>>>>
>.>>>>>>>>>>>>>>>>..>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
Resolution2.72 Å
Binding residue
(original residue number in PDB)		T2 G4 I9 F11 R12 R13 R15 T19 Y21 R24 R34 R38 T40 N41 K42 Y43 K54 D56 M58 Y61 D76 N79 T80 V110 V112 K113 G115 R116 R142 H147 Y151 Y163 N164 K165 L166 F167 Y170
Binding residue
(residue number reindexed from 1)		T1 G3 I8 F10 R11 R12 R14 T18 Y20 R23 R33 R37 T39 N40 K41 Y42 K53 D55 M57 Y60 D75 N78 T79 V109 V111 K112 G114 R115 R141 H146 Y150 Y162 N163 K164 L165 F166 Y169
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hku, PDBe:8hku, PDBj:8hku
PDBsum8hku
PubMed37604686
UniProtO05640|RL18_SULAC Large ribosomal subunit protein uL18 (Gene Name=rpl18)

[Back to BioLiP]