Structure of PDB 7azs Chain L18A Binding Site BS02

Receptor Information
>7azs Chain L18A (length=112) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MARLTAYERRKFRVRNRIKRTGRLRLSVFRSLKHIYAQIIDDEKGVTLVS
ASSLALKLKGNKTEVARQVGRALAEKALALGIKQVAFDRGPYKYHGRVKA
LAEGAREGGLEF
Ligand information
>7azs Chain 5SA (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aaucccccgugcccauagcggcguggaaccacccguucccauuccgaaca
cggaagugaaacgcgccagcgccgaugguacugggcgggcgaccgccugg
gagaguaggucggugcggggga
..<<<<<<<<<<<....<<<<<<<<....<<<<<<...............
>>>..>>>...>>>>>>.>><<<.....<.<<<<<<<<....>>>>>>>>
...>...>>>.>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7azs Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		R15 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 T47 L54 N61 K62 T63 K93 H95 G96 R97
Binding residue
(residue number reindexed from 1)		R15 R25 F29 R30 S31 L32 K33 H34 Y36 Q38 T47 L54 N61 K62 T63 K93 H95 G96 R97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7azs, PDBe:7azs, PDBj:7azs
PDBsum7azs
PubMed36827973
UniProtQ5SHQ4|RL18_THET8 Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]