Structure of PDB 8y6o Chain L Binding Site BS02

Receptor Information
>8y6o Chain L (length=318) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WDSKMFAEIMMKIEEYISKQAPEYRVIVDANNLTVEIENELNIIHKFIRD
KYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILTNATIMV
VSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIA
PNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSVLPHTG
YIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKD
EIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIR
KQANRMSFGEIEEDAYQE
Ligand information
>8y6o Chain K (length=44) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuagcacuccccuugacaaggauggaagaggcccugggccuga
.............................<<<<<...>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8y6o Structural basis of U12-type intron engagement by the fully assembled human minor spliceosome
Resolution3.38 Å
Binding residue
(original residue number in PDB)		K352 G355 G356 R357
Binding residue
(residue number reindexed from 1)		K280 G283 G284 R285
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030621 U4 snRNA binding
GO:0030622 U4atac snRNA binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0043021 ribonucleoprotein complex binding
GO:0070990 snRNP binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0048254 snoRNA localization
GO:0071166 ribonucleoprotein complex localization
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005687 U4 snRNP
GO:0005690 U4atac snRNP
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0071339 MLL1 complex
GO:0097526 spliceosomal tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8y6o, PDBe:8y6o, PDBj:8y6o
PDBsum8y6o
PubMed38484052
UniProtQ8WWY3|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 (Gene Name=PRPF31)

[Back to BioLiP]