Structure of PDB 8v87 Chain L Binding Site BS02

Receptor Information

>8v87 Chain L (length=121) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPLDLLRPVV
RAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQNRNQEI
FDANVQRLKEYQSKIIVFPRN

Ligand information

>8v87 Chain 2 (length=155) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaacuuucaacaacggaucucuugguucucgcaucgaugaagaacgcagc
gaaaugcgauacguaaugugaauugcagaauuccgugaaucaucgaaucu
uugaacgcacgcgccccuugguauuccagggggcaugccuguuugagcgu
cauuu

.........................................<<<<<<.<<
.....>>>.....(.<<<......>>..............>>>..)...>
>>....<<..>><<<<<<<<<....>>>>>>>>>................
.....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8v87 The DEAD-box ATPase Dbp10/DDX54 initiates peptidyl transferase center formation during 60S ribosome biogenesis.
Resolution	2.66 Å
Binding residue (original residue number in PDB)	F26 D27 S34
Binding residue (residue number reindexed from 1)	F18 D19 S26

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8v87, PDBe:8v87, PDBj:8v87
PDBsum	8v87
PubMed	38632236
UniProt	Q12690\|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)

[Back to BioLiP]