Structure of PDB 8q7n Chain L Binding Site BS02

Receptor Information
>8q7n Chain L (length=373) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKLWDSKMFAEIMMKIEEYISKQAKASEVAAPEYRVIVDANNLTVEIENE
LNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQ
QILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYE
YVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQR
KTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVD
SFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLRKKRGGRRY
RKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQ
TQVNEATKARISKTLQRTLQKQS
Ligand information
>8q7n Chain 4 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcuuugcgcaguggcaguaucguagccaaugagguuuauccgaggcgcg
auuauugcuaauacuuuucccaauac
...................<<<<<.<<<.....<<.....>>..>>>>>>
>>........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q7n New insights into the functions of B complex proteins revealed by cryo-EM of dimerized spliceosomes
Resolution3.1 Å
Binding residue
(original residue number in PDB)		C247 N248 L251 L252 H270 R293 A297 K298 L301 K327 K338 K341 K352 K353 R354 R357 R358 K361 S421 K422 T423
Binding residue
(residue number reindexed from 1)		C191 N192 L195 L196 H214 R237 A241 K242 L245 K271 K282 K285 K293 K294 R295 R298 R299 K302 S362 K363 T364
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030621 U4 snRNA binding
GO:0030622 U4atac snRNA binding
GO:0030674 protein-macromolecule adaptor activity
GO:0042802 identical protein binding
GO:0043021 ribonucleoprotein complex binding
GO:0070990 snRNP binding
Biological Process
GO:0000244 spliceosomal tri-snRNP complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0048254 snoRNA localization
GO:0071166 ribonucleoprotein complex localization
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005687 U4 snRNP
GO:0005690 U4atac snRNP
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0071339 MLL1 complex
GO:0097526 spliceosomal tri-snRNP complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q7n, PDBe:8q7n, PDBj:8q7n
PDBsum8q7n
PubMed38383864
UniProtQ8WWY3|PRP31_HUMAN U4/U6 small nuclear ribonucleoprotein Prp31 (Gene Name=PRPF31)

[Back to BioLiP]