Structure of PDB 8igs Chain L Binding Site BS02

Receptor Information
>8igs Chain L (length=309) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRTTDPVRMYMREMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAI
TYLLEQYDRVEAMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFL
DLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRI
PVHMIETINKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAK
EPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESLRAATHDVLAGLT
AREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPS
RSEVLRSFL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8igs Structural basis of lambda CII-dependent transcription activation.
Resolution3.4 Å
Binding residue
(original residue number in PDB)		T440 R562 L573
Binding residue
(residue number reindexed from 1)		T138 R260 L271
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0005515 protein binding
GO:0016987 sigma factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006355 regulation of DNA-templated transcription
GO:0009408 response to heat
GO:0010468 regulation of gene expression
GO:0045892 negative regulation of DNA-templated transcription
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0000345 cytosolic DNA-directed RNA polymerase complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:1903865 sigma factor antagonist complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8igs, PDBe:8igs, PDBj:8igs
PDBsum8igs
PubMed37269829
UniProtP00579|RPOD_ECOLI RNA polymerase sigma factor RpoD (Gene Name=rpoD)

[Back to BioLiP]