Structure of PDB 8ejl Chain L Binding Site BS02

Receptor Information

>8ejl Chain L (length=202) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PIVVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLN
TVGGHQAAMQMLKETINEEAAEWDRLHPEPRGSDIAGTTSTLQEQIGWMT
HNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFY
KTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
GV

Ligand information

>8ejl Chain Z (length=13) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

PVLFPGQPFGQPP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8ejl A molecular switch modulates assembly and host factor binding of the HIV-1 capsid.
Resolution	3.9 Å
Binding residue (original residue number in PDB)	Q179 N183
Binding residue (residue number reindexed from 1)	Q160 N164

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0016032	viral process

View graph for
Biological Process

External links

PDB	RCSB:8ejl, PDBe:8ejl, PDBj:8ejl
PDBsum	8ejl
PubMed	36759579
UniProt	P12493\|GAG_HV1N5 Gag polyprotein (Gene Name=gag)

[Back to BioLiP]