Structure of PDB 8a4i Chain L Binding Site BS02

Receptor Information

>8a4i Chain L (length=56) Species: 10090 (Mus musculus)

KQHCCTRCGKNFSSASALQIHERTHTGEKPFVCNICGRAFTTKGNLKVHY
MTHGAN

Ligand information

>8a4i Chain D (length=12)

gatattaatatc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8a4i Structure of SALL4 zinc finger domain reveals link between AT-rich DNA binding and Okihiro syndrome.
• Resolution: 2.76 Å
• Binding residue (original residue number in PDB): K920 G921
• Binding residue (residue number reindexed from 1): K43 G44

External links

• PDB: RCSB:8a4i, PDBe:8a4i, PDBj:8a4i
• PDBsum: 8a4i
• PubMed: 36635047
• UniProt: Q8BX22|SALL4_MOUSE Sal-like protein 4 (Gene Name=Sall4)