Structure of PDB 7k53 Chain L Binding Site BS02

Receptor Information
>7k53 Chain L (length=151) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
A
Ligand information
>7k53 Chain 6 (length=77) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cgcgggguggagcagccugguagcucgucgggcucauaacccgaaggucg
ucgguucaaauccggcccccgcaacca
.<<<<<<..<<<<.........>>>>.<<<<<.......>>>>.>....<
<<<<.......>>>>>>>>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k53 Structural basis for +1 ribosomal frameshifting during EF-G-catalyzed translocation.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		S76 R78 G81 S82 T83 Q85
Binding residue
(residue number reindexed from 1)		S76 R78 G81 S82 T83 Q85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0015935 small ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7k53, PDBe:7k53, PDBj:7k53
PDBsum7k53
PubMed34330903
UniProtP02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]