Structure of PDB 7ezj Chain L Binding Site BS02

Receptor Information
>7ezj Chain L (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPI
QIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPA
SHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSS
CVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ezj Deciphering the mechanism of p73 recognition of p53 response elements using the crystal structure of p73-DNA complexes and computational studies.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		N259 S261 R268 R293 A296 C297 R300
Binding residue
(residue number reindexed from 1)		N148 S150 R157 R182 A185 C186 R189
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006915 apoptotic process
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ezj, PDBe:7ezj, PDBj:7ezj
PDBsum7ezj
PubMed35217090
UniProtO15350|P73_HUMAN Tumor protein p73 (Gene Name=TP73)

[Back to BioLiP]