Structure of PDB 7c7a Chain L Binding Site BS02

Receptor Information
>7c7a Chain L (length=131) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EMDNVIRSLEQEYRLILLLNHRNKNQHRAASWYGSFNEMKRNCGQIITLF
SSRRLQAKRLKDVEWVKLHRLLQRALFRQLKRWYWQFNGVIALGQFVTLG
CTLVTLLANVRALYMRLWEINETEFIRCGCL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7c7a Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R24 Q28 Q97 F98
Binding residue
(residue number reindexed from 1)		R22 Q26 Q95 F96
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0042134 rRNA primary transcript binding
Biological Process
GO:0000294 nuclear-transcribed mRNA catabolic process, RNase MRP-dependent
GO:0000460 maturation of 5.8S rRNA
GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
Cellular Component
GO:0000172 ribonuclease MRP complex
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7c7a, PDBe:7c7a, PDBj:7c7a
PDBsum7c7a
PubMed32586950
UniProtQ12530|RMP1_YEAST Ribonuclease MRP protein subunit RMP1 (Gene Name=RMP1)

[Back to BioLiP]