Structure of PDB 7a18 Chain L Binding Site BS02

Receptor Information

>7a18 Chain L (length=104) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539)

RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSA
ALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAA
REGG

Ligand information

>7a18 Chain Y (length=122)

cacccccgugcccauagcacuguggaaccaccccaccccaugccgaacug
ggucgugaaacacagcagcgccaaugauacucggaccgcagggucccgga
aaagucggucagcgcggggguu

.<<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>
>>..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>.
......>>>..>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7a18 Ribosome-binding and anti-microbial studies of the mycinamicins, 16-membered macrolide antibiotics from Micromonospora griseorubida.
• Resolution: 3.4 Å
• Binding residue (original residue number in PDB): R28 Y32 S35 H37 Q41 G48 Q49 T50 A53 S55 N63 T65 Y94 K95 H97 R99
• Binding residue (residue number reindexed from 1): R21 Y25 S28 H30 Q34 G41 Q42 T43 A46 S48 N56 T58 Y87 K88 H90 R92

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7a18, PDBe:7a18, PDBj:7a18
• PDBsum: 7a18
• PubMed: 34417608
• UniProt: Q9RSL2|RL18_DEIRA Large ribosomal subunit protein uL18 (Gene Name=rplR)