Structure of PDB 6exn Chain L Binding Site BS02

Receptor Information

>6exn Chain L (length=156) Species: 559292 (Saccharomyces cerevisiae S288C)

PRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLWE
IMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKTGYE
KLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGCR
GCASTD

Ligand information

>6exn Chain 6 (length=102)

guucgcgaaguaacccuucguggacauuuggucaauuugaaacaauacag
agaugaucagcaguuccccugcauaaggaugaaccguuuuacaaagagau
uu

<<<<<<<<<<.....>>>>>>>>>>.........................
............<<<..<<<.....>>>...>>>................
..

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6exn Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
• Resolution: 3.7 Å
• Binding residue (original residue number in PDB): K40 L41 A42 T98 G99 E101 K102 T114 N115 N116 S118 T119 C120 I121 R123 Q128 E132 F142 V146 S155 T156
• Binding residue (residue number reindexed from 1): K39 L40 A41 T97 G98 E100 K101 T113 N114 N115 S117 T118 C119 I120 R122 Q127 E131 F141 V145 S154 T155

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0005515 protein binding

Biological Process

• GO:0000282 cellular bud site selection
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005686 U2 snRNP

External links

• PDB: RCSB:6exn, PDBe:6exn, PDBj:6exn
• PDBsum: 6exn
• PubMed: 29146871
• UniProt: P25337|BUD31_YEAST Pre-mRNA-splicing factor BUD31 (Gene Name=BUD31)