Structure of PDB 6es2 Chain L Binding Site BS02

Receptor Information
>6es2 Chain L (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQ
NRRAKERKINKKKLQQQQQQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6es2 Two distinct DNA sequences recognized by transcription factors represent enthalpy and entropy optima.
Resolution2.95 Å
Binding residue
(original residue number in PDB)		Y189 R190 Q235 R238 R242
Binding residue
(residue number reindexed from 1)		Y4 R5 Q50 R53 R57
Binding affinityPDBbind-CN: Kd=0.105uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6es2, PDBe:6es2, PDBj:6es2
PDBsum6es2
PubMed29638214
UniProtQ99626|CDX2_HUMAN Homeobox protein CDX-2 (Gene Name=CDX2)

[Back to BioLiP]