Structure of PDB 6asb Chain L Binding Site BS02

Receptor Information
>6asb Chain L (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRRRTRCRRCRACVRTECGDCHFCRDMKKFGGPGRMKQSCLLRQCTAPVL
PHTAVCLLCGEAGKEDTGEEEKFGLSLMECTICNEIVHPGCEGVINAEIP
NCWECPRCTQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6asb DNA Sequence Recognition of Human CXXC Domains and Their Structural Determinants.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		R33 R34 R40 R67 M68 K69 Q70 P83 H84
Binding residue
(residue number reindexed from 1)		R1 R2 R8 R35 M36 K37 Q38 P51 H52
Binding affinityPDBbind-CN: Kd=1.5uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding

View graph for
Molecular Function
External links
PDB RCSB:6asb, PDBe:6asb, PDBj:6asb
PDBsum6asb
PubMed29276034
UniProtQ6PCT2|FXL19_HUMAN F-box/LRR-repeat protein 19 (Gene Name=FBXL19)

[Back to BioLiP]