Structure of PDB 5mdx Chain L Binding Site BS02

Receptor Information
>5mdx Chain L (length=36) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSNPNEQSVELNRTSLYWGLLLIFVLAVLFSNYFFN
Ligand information
>5mdx Chain T (length=29) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MEALVYTFLLVSTLGIIFFAIFFREPPKI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mdx Subunit and chlorophyll organization of the plant photosystem II supercomplex.
Resolution5.3 Å
Binding residue
(original residue number in PDB)		R15 F26 V30 N34 F37
Binding residue
(residue number reindexed from 1)		R13 F24 V28 N32 F35
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009539 photosystem II reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5mdx, PDBe:5mdx, PDBj:5mdx
PDBsum5mdx
PubMed28604725
UniProtP60129|PSBL_ARATH Photosystem II reaction center protein L (Gene Name=psbL)

[Back to BioLiP]