Structure of PDB 5lj3 Chain L Binding Site BS02

Receptor Information
>5lj3 Chain L (length=155) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PRIKTRRSKPAPDGFEKIKPTLTDFEIQLRDAQKDKSSKLAAKSNEQLWE
IMQLHHQRSRYIYTLYYKRKAISKDLYDWLIKEKYADKLLIAKWRKTGYE
KLCCLRCIQKNETNNGSTCICRVPRAQLEEEARKKGTQVSFHQCVHCGCR
GCAST
Ligand information
>5lj3 Chain V (length=97) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guucgcgaagcuucguggacauuuggucaauuugaaacaauacagagaug
aucagcaguuccccugcauaaggaugaaccguuuuacaaagagauuu
<<<<<<<<<..>>>>>>>>>..............................
.......<<<..<<<.....>>>...>>>..................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lj3 Cryo-EM structure of the spliceosome immediately after branching.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		K40 L41 A42 T98 G99 E101 K102 T114 N115 N116 T119 C120 I121 R123 V124 P125 Q128 L129 C145 V146 H147 S155 T156
Binding residue
(residue number reindexed from 1)		K39 L40 A41 T97 G98 E100 K101 T113 N114 N115 T118 C119 I120 R122 V123 P124 Q127 L128 C144 V145 H146 S154 T155
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005515 protein binding
Biological Process
GO:0000282 cellular bud site selection
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5lj3, PDBe:5lj3, PDBj:5lj3
PDBsum5lj3
PubMed27459055
UniProtP25337|BUD31_YEAST Pre-mRNA-splicing factor BUD31 (Gene Name=BUD31)

[Back to BioLiP]