Structure of PDB 5kc1 Chain L Binding Site BS02

Receptor Information
>5kc1 Chain L (length=60) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KNSEMKINLRLEQFKKELVLYEQKKFKEYGMKIDEITKENKKLANEIGRL
RERWDSLVES
Ligand information
>5kc1 Chain I (length=29) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DTLSPINDPLLMSILNRLQFNLNNDIQLK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kc1 Characterization of Atg38 and NRBF2, a fifth subunit of the autophagic Vps34/PIK3C3 complex.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		N164 L167 E168 K171 V175 E178 Q179
Binding residue
(residue number reindexed from 1)		N8 L11 E12 K15 V19 E22 Q23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0006914 autophagy
GO:0016236 macroautophagy
GO:0046854 phosphatidylinositol phosphate biosynthetic process
Cellular Component
GO:0000407 phagophore assembly site
GO:0005737 cytoplasm
GO:0005774 vacuolar membrane
GO:0016020 membrane
GO:0034045 phagophore assembly site membrane
GO:0034271 phosphatidylinositol 3-kinase complex, class III, type I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5kc1, PDBe:5kc1, PDBj:5kc1
PDBsum5kc1
PubMed27630019
UniProtQ05789|ATG38_YEAST Autophagy-related protein 38 (Gene Name=ATG38)

[Back to BioLiP]