Structure of PDB 5bqq Chain L Binding Site BS02

Receptor Information
>5bqq Chain L (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPGH
Ligand information
>5bqq Chain K (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5bqq Rational steering of insulin binding specificity by intra-chain chemical crosslinking.
Resolution1.54 Å
Binding residue
(original residue number in PDB)
Q4 C7 L11 L15 C19 R22 G23
Binding residue
(residue number reindexed from 1)
Q4 C7 L11 L15 C19 R22 G23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:5bqq, PDBe:5bqq, PDBj:5bqq
PDBsum5bqq
PubMed26792393
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]