Structure of PDB 4wce Chain L Binding Site BS02

Receptor Information

>4wce Chain L (length=110) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

MISKIDKNKVRLKRHARVRTNLSGTAEKPRLNVYRSNKHIYAQIIDDNKG
VTLAQASSKDSDIATTATKVELATKVGEAIAKKAADKGIKEIVFDRGGYL
YHGRVKALAE

Ligand information

>4wce Chain Y (length=114)

ucuggugacuauagcaaggaggucacaccuguucccaugccgaacacaga
aguuaaggucuuuagcgacgaugguagccaacuuacguuccgcuagagua
gaacguugccaggc

.<<.<..<.....<<<<<<<......<<<<<...............>>>.
.>>.....>>>>>.>><.........<.<............>.>......
...>..>..>.>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4wce Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.
• Resolution: 3.526 Å
• Binding residue (original residue number in PDB): R11 R30 N32 Y34 R35 S36 N37 H39 Y41 Q43 V51 T52 Q55 T66 A67 G98 Y99
• Binding residue (residue number reindexed from 1): R11 R30 N32 Y34 R35 S36 N37 H39 Y41 Q43 V51 T52 Q55 T66 A67 G98 Y99

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4wce, PDBe:4wce, PDBj:4wce
• PDBsum: 4wce
• PubMed: 26464510
• UniProt: Q2FW22|RL18_STAA8 Large ribosomal subunit protein uL18 (Gene Name=rplR)