Structure of PDB 4io9 Chain L Binding Site BS02

Receptor Information

>4io9 Chain L (length=104) Species: 1299 (Deinococcus radiodurans)

RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSA
ALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAA
REGG

Ligand information

>4io9 Chain Y (length=122)

cacccccgugcccauagcacuguggaaccaccccaccccaugccgaacug
ggucgugaaacacagcagcgccaaugauacucggaccgcagggucccgga
aaagucggucagcgcggggguu

.<<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>
>>..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>.
......>>>..>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 4io9 Novel 3-O-carbamoyl erythromycin A derivatives (carbamolides) with activity against resistant staphylococcal and streptococcal isolates.
• Resolution: 3.2 Å
• Binding residue (original residue number in PDB): K16 R28 Y32 S34 S35 H37 Y39 Q41 G48 Q49 T50 S55 A58 K64 T65 D66 Y94 K95 H97 G98 R99
• Binding residue (residue number reindexed from 1): K9 R21 Y25 S27 S28 H30 Y32 Q34 G41 Q42 T43 S48 A51 K57 T58 D59 Y87 K88 H90 G91 R92

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4io9, PDBe:4io9, PDBj:4io9
• PDBsum: 4io9
• PubMed: 23414806
• UniProt: Q9RSL2|RL18_DEIRA Large ribosomal subunit protein uL18 (Gene Name=rplR)