Structure of PDB 3pio Chain L Binding Site BS02

Receptor Information
>3pio Chain L (length=104) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSA
ALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAA
REGG
Ligand information
>3pio Chain Y (length=120) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acccccgugcccauagcacuguggaaccaccccaccccaugccgaacugg
gucgugaaacacagcagcgccaaugauacucggaccgcagggucccggaa
aagucggucagcgcgggggu
<<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>>
>..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>..
.....>>>..>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3pio Crystal structure of the synergistic antibiotic pair, lankamycin and lankacidin, in complex with the large ribosomal subunit.
Resolution3.2473 Å
Binding residue
(original residue number in PDB)
K16 R28 Y32 S34 S35 H37 Y39 Q41 G48 Q49 T50 S55 A57 T65 K95 H97 G98
Binding residue
(residue number reindexed from 1)
K9 R21 Y25 S27 S28 H30 Y32 Q34 G41 Q42 T43 S48 A50 T58 K88 H90 G91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3pio, PDBe:3pio, PDBj:3pio
PDBsum3pio
PubMed21282615
UniProtQ9RSL2|RL18_DEIRA Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]