Structure of PDB 2zjq Chain L Binding Site BS02

Receptor Information

>2zjq Chain L (length=104) Species: 1299 (Deinococcus radiodurans)

RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSA
ALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAA
REGG

Ligand information

>2zjq Chain Y (length=122)

cacccccgugcccauagcacuguggaaccaccccaccccaugccgaacug
ggucgugaaacacagcagcgccaaugauacucggaccgcagggucccgga
aaagucggucagcgcggggguu

.<<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>
>>..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>.
......>>>..>>>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2zjq Translational regulation via L11: molecular switches on the ribosome turned on and off by thiostrepton and micrococcin.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): K16 R28 Y32 S35 H37 Y39 Q41 G48 Q49 T50 A57 K64 T65 D66 Y94 K95 H97 R99
• Binding residue (residue number reindexed from 1): K9 R21 Y25 S28 H30 Y32 Q34 G41 Q42 T43 A50 K57 T58 D59 Y87 K88 H90 R92

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:2zjq, PDBe:2zjq, PDBj:2zjq
• PDBsum: 2zjq
• PubMed: 18406324
• UniProt: Q9RSL2|RL18_DEIRA Large ribosomal subunit protein uL18 (Gene Name=rplR)