Structure of PDB 2zjp Chain L Binding Site BS02

Receptor Information
>2zjp Chain L (length=104) Species: 1299 (Deinococcus radiodurans) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRKLRTRRKVRTTTAASGRLRLSVYRSSKHIYAQIIDDSRGQTLAAASSA
ALKSGNKTDTAAAVGKALAAAAAEKGIKQVVFDRGSYKYHGRVKALADAA
REGG
Ligand information
>2zjp Chain Z (length=122) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacccccgugcccauagcacuguggaaccaccccaccccaugccgaacug
ggucgugaaacacagcagcgccaaugauacucggaccgcagggucccgga
aaagucggucagcgcggggguu
.<<<<<<<<<<.....<<.<<<<<....<<<<<<<.............>>
>>..>>>...>>>>>..>><<<.......<<.<<<<<....>>>>>.>>.
......>>>..>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zjp Translational Regulation Via L11: Molecular Switches on the Ribosome Turned on and Off by Thiostrepton and Micrococcin.
Resolution3.7 Å
Binding residue
(original residue number in PDB)
K16 R28 Y32 S34 S35 H37 Y39 Q41 G48 Q49 T50 A57 K64 T65 Y94 K95 H97 G98 R99
Binding residue
(residue number reindexed from 1)
K9 R21 Y25 S27 S28 H30 Y32 Q34 G41 Q42 T43 A50 K57 T58 Y87 K88 H90 G91 R92
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2zjp, PDBe:2zjp, PDBj:2zjp
PDBsum2zjp
PubMed18406324
UniProtQ9RSL2|RL18_DEIRA Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]