Structure of PDB 2wwb Chain L Binding Site BS02

Receptor Information
>2wwb Chain L (length=127) Species: 4565 (Triticum aestivum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPI
RRDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLH
PSKLVITKLHLDKDRKALIQRKGGKLE
Ligand information
>2wwb Chain E (length=34) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ugaaaagaacuuugaaaagagagugaaaaaguac
.........<<<<....>>>>.............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wwb Structure of Monomeric Yeast and Mammalian Sec61 Complexes Interacting with the Translating Ribosome.
Resolution6.48 Å
Binding residue
(original residue number in PDB)		S62 K63 K77 K87 K89 V90 N91 V95 P96 N98
Binding residue
(residue number reindexed from 1)		S62 K63 K77 K87 K89 V90 N91 V95 P96 N98
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0032991 protein-containing complex
GO:0043232 intracellular non-membrane-bounded organelle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2wwb, PDBe:2wwb, PDBj:2wwb
PDBsum2wwb
PubMed19933108
UniProtP05743|RL26A_YEAST Large ribosomal subunit protein uL24A (Gene Name=RPL26A)

[Back to BioLiP]