Structure of PDB 2wj8 Chain L Binding Site BS02

Receptor Information
>2wj8 Chain L (length=377) Species: 11260 (Human respiratory syncytial virus A strain Long) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALSKVKLNDTLNKDQLLSSSKYTIQRSTGDSIDTPNYDVQKHINKLCGML
LITEDANHKFTGLIGMLYAMSRLGREDTIKILRDAGYHVKANGVDVTTHR
QDINGKEMKFEVLTLASLTTEIQINIEIESRKSYKKMLKEMGEVAPEYRH
DSPDCGMIILCIAALVITKLAAGDRSGLTAVIRRANNVLKNEMKRYKGLL
PKDIANSFYEVFEKHPHFIDVFVHFGIAQSSTRGGSRVEGIFAGLFMNAY
GAGQVMLRWGVLAKSVKNIMLGHASVQAEMEQVVEVYEYAQKLGGEAGFY
HILNNPKASLLSLTQFPHFSSVVLGNAAGLGIMGEYRGTPRNQDLYDAAK
AYAEQLKENGVINYSVLDLTAEELEAI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wj8 Crystal Structure of a Nucleocapsid-Like Nucleoprotein-RNA Complex of Respiratory Syncytial Virus
Resolution3.29 Å
Binding residue
(original residue number in PDB)
R185 V189 I242
Binding residue
(residue number reindexed from 1)
R184 V188 I241
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030291 protein serine/threonine kinase inhibitor activity
Biological Process
GO:0019049 virus-mediated perturbation of host defense response
GO:0039502 symbiont-mediated suppression of host type I interferon-mediated signaling pathway
GO:0039545 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MAVS activity
GO:0039554 symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of MDA-5 activity
GO:0039580 symbiont-mediated suppression of host PKR/eIFalpha signaling
GO:0085034 symbiont-mediated suppression of host NF-kappaB cascade
Cellular Component
GO:0019013 viral nucleocapsid
GO:0019028 viral capsid
GO:0019029 helical viral capsid
GO:0030430 host cell cytoplasm
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:2wj8, PDBe:2wj8, PDBj:2wj8
PDBsum2wj8
PubMed19965480
UniProtP03418|NCAP_HRSVA Nucleoprotein (Gene Name=N)

[Back to BioLiP]