Structure of PDB 2or1 Chain L Binding Site BS02

Receptor Information
>2or1 Chain L (length=63) Species: 10712 (Phage 434) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELAS
ALGVSVDWLLNGT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2or1 Recognition of a DNA operator by the repressor of phage 434: a view at high resolution.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q17 Q28 E32 N36 R43
Binding residue
(residue number reindexed from 1)		Q17 Q28 E32 N36 R43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:2or1, PDBe:2or1, PDBj:2or1
PDBsum2or1
PubMed3187531
UniProtP16117|RPC1_BP434 Repressor protein CI (Fragment) (Gene Name=CI)

[Back to BioLiP]