Structure of PDB 1rpe Chain L Binding Site BS02

Receptor Information
>1rpe Chain L (length=63) Species: 10712 (Phage 434) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELAS
ALGVSVDWLLNGT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rpe The phage 434 OR2/R1-69 complex at 2.5 A resolution.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		Q17 Q28 E32 N36 R43
Binding residue
(residue number reindexed from 1)		Q17 Q28 E32 N36 R43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1rpe, PDBe:1rpe, PDBj:1rpe
PDBsum1rpe
PubMed8355273
UniProtP16117|RPC1_BP434 Repressor protein CI (Fragment) (Gene Name=CI)

[Back to BioLiP]