Structure of PDB 1per Chain L Binding Site BS02

Receptor Information
>1per Chain L (length=63) Species: 10712 (Phage 434) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SISSRVKSKRIQLGLNQAELAQKVGTTQQSIEQLENGKTKRPRFLPELAS
ALGVSVDWLLNGT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1per The complex between phage 434 repressor DNA-binding domain and operator site OR3: structural differences between consensus and non-consensus half-sites.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		N16 Q17 Q28 E32 N36 R43
Binding residue
(residue number reindexed from 1)		N16 Q17 Q28 E32 N36 R43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1per, PDBe:1per, PDBj:1per
PDBsum1per
PubMed8081737
UniProtP16117|RPC1_BP434 Repressor protein CI (Fragment) (Gene Name=CI)

[Back to BioLiP]