Structure of PDB 8q7n Chain K Binding Site BS02

Receptor Information
>8q7n Chain K (length=135) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELR
ANGKVITNKAVKGKYKFLQKYYHRGAFFMDEDEEVYKRDFSAPTLEDHFN
KTILPKVMQVKNFGRSGRTKYTHLVDQDTTSFDSA
Ligand information
>8q7n Chain Z (length=31) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccuccgaacgguaagagccuagcauguagaa
...............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8q7n New insights into the functions of B complex proteins revealed by cryo-EM of dimerized spliceosomes
Resolution3.1 Å
Binding residue
(original residue number in PDB)		Y335 F337 K340 Y341 K381 Y391 H393 L394 V395
Binding residue
(residue number reindexed from 1)		Y65 F67 K70 Y71 K111 Y121 H123 L124 V125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0001527 microfibril
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005684 U2-type spliceosomal complex
GO:0005813 centrosome
GO:0071005 U2-type precatalytic spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q7n, PDBe:8q7n, PDBj:8q7n
PDBsum8q7n
PubMed38383864
UniProtP55081|MFAP1_HUMAN Microfibrillar-associated protein 1 (Gene Name=MFAP1)

[Back to BioLiP]