Structure of PDB 8ovj Chain K Binding Site BS02

Receptor Information
>8ovj Chain K (length=170) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VKSHYICAGRLVRILRGPRQDRVGVIVDIVDANRVLVENPEDAKMWRHVQ
NLKNVEPLKYCVSVSRNCSAKALKDALASSKALEKYAKTRTAARVEAKKA
CAVSTDFERYQLRVARRSRAHWARKVFDEKDAKTPVSWHKVALKKMLKKA
AKMDSTEGAKRRMQKAIAAR
Ligand information
>8ovj Chain 6 (length=71) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aucgaaucgccaccuacaagacuggagcuugcucccucgaaggcgccaag
uauauucaugaucacaagaca
......<.<<<............<<<<<..>>>>>......>>>......
..................>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		V2 K3 S4 Y6 R91 T92 R95 R114 R118 H122 W123 R125 W139
Binding residue
(residue number reindexed from 1)		V1 K2 S3 Y5 R90 T91 R94 R113 R117 H121 W122 R124 W138
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ovj, PDBe:8ovj, PDBj:8ovj
PDBsum8ovj
PubMed38722744
UniProtQ4QBJ1

[Back to BioLiP]