Structure of PDB 8iej Chain K Binding Site BS02

Receptor Information
>8iej Chain K (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>8iej Chain J (length=147) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ctggagaatcccggtgccgaggccgctcaattggtcgtagacagctctag
caccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaagg
ggattactccctagtctccaggcacgtgtcagatatatacatcctgt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8iej Mechanistic insights into nucleosomal H2B monoubiquitylation mediated by yeast Bre1-Rad6 and its human homolog RNF20/RNF40-hRAD6A.
Resolution3.12 Å
Binding residue
(original residue number in PDB)		R40 Y41 G44 V46 R49 L65 R69
Binding residue
(residue number reindexed from 1)		R4 Y5 G8 V10 R13 L29 R33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8iej, PDBe:8iej, PDBj:8iej
PDBsum8iej
PubMed37633270
UniProtP68431|H31_HUMAN Histone H3.1 (Gene Name=H3C1)

[Back to BioLiP]