Structure of PDB 8hni Chain K Binding Site BS02

Receptor Information
>8hni Chain K (length=161) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFG
FVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLF
VGDTEEHHLRDYFEEYGKIDTIEIITKKFGFVTFDDHDPVDKIVLQKYHT
IVRKALSRQEM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8hni Structural Insight Into hnRNP A2/B1 Homodimerization and DNA Recognition.
Resolution2.644 Å
Binding residue
(original residue number in PDB)		K113 F115 F155 F157 R185 K186 A187 L188 R190 Q191 M193
Binding residue
(residue number reindexed from 1)		K98 F100 F129 F131 R153 K154 A155 L156 R158 Q159 M161
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:8hni, PDBe:8hni, PDBj:8hni
PDBsum8hni
PubMed36528084
UniProtP22626|ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 (Gene Name=HNRNPA2B1)

[Back to BioLiP]