Structure of PDB 8ebu Chain K Binding Site BS02

Receptor Information
>8ebu Chain K (length=172) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLK
DCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALE
EAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEEN
LEDDMYRKTCTMCGHELTYEKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ebu Lesion recognition by XPC, TFIIH and XPA in DNA excision repair.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		T140 K141 T142 H171 W175 G176 M178 K179 M214 K217 K218
Binding residue
(residue number reindexed from 1)		T39 K40 T41 H70 W74 G75 M77 K78 M113 K116 K117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0005515 protein binding
GO:0019904 protein domain specific binding
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0000715 nucleotide-excision repair, DNA damage recognition
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006289 nucleotide-excision repair
GO:0009650 UV protection
GO:0010996 response to auditory stimulus
GO:0034504 protein localization to nucleus
GO:0070914 UV-damage excision repair
GO:1901255 nucleotide-excision repair involved in interstrand cross-link repair
Cellular Component
GO:0000110 nucleotide-excision repair factor 1 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005662 DNA replication factor A complex
GO:0045171 intercellular bridge

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ebu, PDBe:8ebu, PDBj:8ebu
PDBsum8ebu
PubMed37076618
UniProtP23025|XPA_HUMAN DNA repair protein complementing XP-A cells (Gene Name=XPA)

[Back to BioLiP]