Structure of PDB 8ebt Chain K Binding Site BS02

Receptor Information
>8ebt Chain K (length=172) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLK
DCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALE
EAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETIVHQHEYGPEEN
LEDDMYRKTCTMCGHELTYEKM
Ligand information
>8ebt Chain M (length=45) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atatcgcacgtctattatcctcagcgcaatcagctgtgactacct
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ebt Lesion recognition by XPC, TFIIH and XPA in DNA excision repair.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		T140 T142 Q174 W175 M178 K179 M214 K218
Binding residue
(residue number reindexed from 1)		T39 T41 Q73 W74 M77 K78 M113 K117
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003684 damaged DNA binding
Biological Process
GO:0006289 nucleotide-excision repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8ebt, PDBe:8ebt, PDBj:8ebt
PDBsum8ebt
PubMed37076618
UniProtP23025|XPA_HUMAN DNA repair protein complementing XP-A cells (Gene Name=XPA)

[Back to BioLiP]