Structure of PDB 8dga Chain K Binding Site BS02

Receptor Information
>8dga Chain K (length=182) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMKTPVSILQELLSRRGITPGYELVQIEGAIHEPTFRFRVSFKDKDTPFT
AMGAGRSKKEAKHAAARALIDKLITQHSNKVSQFHKTLKNATGKKLLKLQ
KTCLKNNKIDYIKLLGEIATENQFEVTYVDIEEKTFSGQFQCLVQLSTLP
VGVCHGSGPTAADAQRHAAQNALEYLKIMTKK
Ligand information
>8dga Chain F (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cuauacaaccuacuaccucucu
......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8dga Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
Resolution3.73 Å
Binding residue
(original residue number in PDB)		F167 K189
Binding residue
(residue number reindexed from 1)		F36 K58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0005515 protein binding
GO:0035197 siRNA binding
GO:1905172 RISC complex binding
Biological Process
GO:0007417 central nervous system development
GO:0009047 dosage compensation by hyperactivation of X chromosome
GO:0010468 regulation of gene expression
GO:0010586 miRNA metabolic process
GO:0030422 siRNA processing
GO:0030718 germ-line stem cell population maintenance
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031054 pre-miRNA processing
GO:0048132 female germ-line stem cell asymmetric division
GO:0070920 regulation of regulatory ncRNA processing
GO:0070922 RISC complex assembly
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016442 RISC complex
GO:0070578 RISC-loading complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8dga, PDBe:8dga, PDBj:8dga
PDBsum8dga
PubMed36182693
UniProtQ9VJY9|LOQS_DROME Protein Loquacious (Gene Name=loqs)

[Back to BioLiP]