Structure of PDB 7xfj Chain K Binding Site BS02

Receptor Information
>7xfj Chain K (length=200) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HLTRLGLEFFDQPAVPLARAFLGQVLVRRLPNGTELRGRIVETEAYLGPE
DEAAHSRGGRQTPRNRGMFMKPGTLYVYIIYGMYFCMNISSQGDGACVLL
RALEPLEGLETMRQLRSTVLKDRELCSGPSKLCQALAINKSFDQRDLAQD
EAVWLERGPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQD
Ligand information
>7xfj Chain J (length=131) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tggagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcccgtgtcag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xfj Structural and mechanistic insights into the DNA glycosylase AAG-mediated base excision in nucleosome.
Resolution3.0 Å
Binding residue
(original residue number in PDB)
R145 Y162 G163
Binding residue
(residue number reindexed from 1)
R64 Y81 G82
Enzymatic activity
Enzyme Commision number 3.2.2.21: DNA-3-methyladenine glycosylase II.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003824 catalytic activity
GO:0003905 alkylbase DNA N-glycosylase activity
GO:0005515 protein binding
GO:0008725 DNA-3-methyladenine glycosylase activity
GO:0016787 hydrolase activity
GO:0019104 DNA N-glycosylase activity
GO:0043916 DNA-7-methylguanine glycosylase activity
GO:0052821 DNA-7-methyladenine glycosylase activity
GO:0052822 DNA-3-methylguanine glycosylase activity
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
GO:0006307 DNA alkylation repair
GO:0045007 depurination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0042645 mitochondrial nucleoid

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7xfj, PDBe:7xfj, PDBj:7xfj
PDBsum7xfj
PubMed37339965
UniProtP29372|3MG_HUMAN DNA-3-methyladenine glycosylase (Gene Name=MPG)

[Back to BioLiP]