Structure of PDB 7chw Chain K Binding Site BS02

Receptor Information
>7chw Chain K (length=67) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELKSLTEIKDVL
ASRGLSLGMRLENWPPA
Ligand information
>7chw Chain G (length=49) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccctgcatccgtgatagcacaatttaacacttttgtcaatcattttgtt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7chw Structural basis for transcription inhibition by E. coli SspA
Resolution3.58 Å
Binding residue
(original residue number in PDB)
L289 K298 S299 L300 T301 E302
Binding residue
(residue number reindexed from 1)
L40 K41 S42 L43 T44 E45
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0005515 protein binding
GO:0016779 nucleotidyltransferase activity
GO:0034062 5'-3' RNA polymerase activity
GO:0046983 protein dimerization activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006879 intracellular iron ion homeostasis
GO:0009408 response to heat
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0036460 cellular response to cell envelope stress
GO:0042128 nitrate assimilation
GO:0044780 bacterial-type flagellum assembly
GO:0048870 cell motility
GO:0071973 bacterial-type flagellum-dependent cell motility
GO:0090605 submerged biofilm formation
GO:2000142 regulation of DNA-templated transcription initiation
Cellular Component
GO:0000345 cytosolic DNA-directed RNA polymerase complex
GO:0000428 DNA-directed RNA polymerase complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0008023 transcription elongation factor complex
GO:0016020 membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7chw, PDBe:7chw, PDBj:7chw
PDBsum7chw
PubMed
UniProtP0A7Z4|RPOA_ECOLI DNA-directed RNA polymerase subunit alpha (Gene Name=rpoA)

[Back to BioLiP]